PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK07467.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 746aa    MW: 84743.6 Da    PI: 4.7493
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK07467.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS370.71.9e-1133647373373
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 lL++cA+avss+d + a +lL+++++++sp+gd  qRla yf+++L arla+  +++++ + l  s  ++ + s+ l+a++l    +P+ kf+ + aN+
  PK07467.1 364 FLLISCAQAVSSDDRRTAYELLKKIRQHSSPNGDGSQRLAYYFANGLDARLAGtgNGTGTGAVLFGSLLARVKASDLLKAFHLNLSSCPFKKFGMFFANK 463
                58**************************************************943445556666778888889*************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                + l+ +e+++++Hi+Df+i +G+QWp ++q L+ R++gpp+lRiTg++ p++g   ke++eetg+rLak++e++gvpf++n++v++++e++++e++++++
  PK07467.1 464 MFLQVAEKATTLHIVDFGILYGFQWPIFIQHLSRRDGGPPNLRITGIEFPQNGfrPKERIEETGRRLAKYCERFGVPFRYNAIVVTKWETIRVEDIKIES 563
                ****************************************************9*********************************************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +E++aVn+ l+l+++l+e+v+    rd+vL+l+++l+P ++v+   + ++n++ F++rf eal ++salfd+l++ ++r++eer  +Er+l+g+ei nv+
  PK07467.1 564 NEVVAVNCLLRLKNVLEETVENCP-RDAVLRLIRKLNPAIFVHNIVNGSYNAPFFVTRFREALFHFSALFDMLDTIIARQNEERLLYERKLFGQEILNVI 662
                ****************88888777.*************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                ace+++r er et+++W+ r  +aGF+++pls++ +++ k  lr+ + + ++++e+s+++++gWk+r ++++S+W
  PK07467.1 663 ACEEEKRMERPETYKQWQVRCLRAGFRSLPLSKELMSKFKEKLRTWYHKDFEIDEDSNWMLQGWKGRIVFATSCW 737
                ***********************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.433336718IPR005202Transcription factor GRAS
PfamPF035146.7E-111364737IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 746 aa     Download sequence    Send to blast
MDPSFSDFSD FTNSFEIENW TSIPNSNDYS VISDEYTVNQ YSSEFDFVDD YPNLFTPPDP  60
DPGNFMPSIN LPSLEDPSFP STTLSPDGNS YTPPLSVNPG SDSPNDESEF SIYVLKFINQ  120
ILMEENMEQE TNTLNDPLGL QVTEKSFYDV LGESYPYPAN QSPTDKKAET PDSNFSVSSS  180
DYGSNSHDAN SPQLLSDLGD HNSSLQSFVP GENNFQFDLA TAQKFFRDSD SVSQFQRGFE  240
EASKFLPKGN QLIIDLESNG FSSQLKTDDA VVKIESESPP NGLRGRKNHE REDDDSEEER  300
SNKQSAHYID DSELSEMFDK VLLQVEPVDN EARKALQPVD SNASSGKGRG KKQNKKSETV  360
DLRFLLISCA QAVSSDDRRT AYELLKKIRQ HSSPNGDGSQ RLAYYFANGL DARLAGTGNG  420
TGTGAVLFGS LLARVKASDL LKAFHLNLSS CPFKKFGMFF ANKMFLQVAE KATTLHIVDF  480
GILYGFQWPI FIQHLSRRDG GPPNLRITGI EFPQNGFRPK ERIEETGRRL AKYCERFGVP  540
FRYNAIVVTK WETIRVEDIK IESNEVVAVN CLLRLKNVLE ETVENCPRDA VLRLIRKLNP  600
AIFVHNIVNG SYNAPFFVTR FREALFHFSA LFDMLDTIIA RQNEERLLYE RKLFGQEILN  660
VIACEEEKRM ERPETYKQWQ VRCLRAGFRS LPLSKELMSK FKEKLRTWYH KDFEIDEDSN  720
WMLQGWKGRI VFATSCWVSA EGPYSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-523667378374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008245986.10.0PREDICTED: scarecrow-like protein 33
RefseqXP_009364377.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009364376.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLW9S2B70.0W9S2B7_9R
STRINGPOPTR_0009s03800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14